PTM Viewer PTM Viewer

AT4G38960.1

Arabidopsis thaliana [ath]

B-box type zinc finger family protein

No PTMs currently found

PLAZA: AT4G38960
Gene Family: HOM05D000578
Other Names: B-box domain protein 19; BBX19

Link out to other resources with this protein ID : TAIR   |   PeptideAtlas   |   ARAPORT   |   PhosPhAt

PTMs

There are no stored PTMs for this protein

Sequence

Length: 183

MRILCDACENAAAIIFCAADEAALCRPCDEKVHMCNKLASRHVRVGLAEPSNAPCCDICENAPAFFYCEIDGSSLCLQCDMVVHVGGKRTHGRFLLLRQRIEFPGDKPKENNTRDNLQNQRVSTNGNGEANGKIDDEMIDLNANPQRVHEPSSNNNGIDVNNENNHEPAGLVPVGPFKRESEK

Domains & Sites

Clear highlighted range 
Interpro Domains
Show IPR ID From To
IPR000315 1 47
51 96
Sites
Show Type Position
Active Site 5
Active Site 8
Active Site 28
Active Site 33
Active Site 56
Active Site 59
Active Site 79
Active Site 84

BLAST


Perform a BLAST search for this sequence, or a part of this sequence (minimum 50 characters)
A downloadable tutorial can be found here